PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G133900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 511aa    MW: 55770.8 Da    PI: 4.9274
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G133900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-183380148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+ Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Manes.02G133900.1.p 33 KGPWTAAEDAILVEYVTKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 80
                         79******************************************9986 PP

2Myb_DNA-binding52.31.3e-1686129146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
  Manes.02G133900.1.p  86 KGAFTPEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 129
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1952880IPR017930Myb domain
SuperFamilySSF466896.74E-3131127IPR009057Homeodomain-like
SMARTSM007171.5E-153282IPR001005SANT/Myb domain
PfamPF002499.9E-163380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-253487IPR009057Homeodomain-like
CDDcd001671.21E-113580No hitNo description
PROSITE profilePS5129426.39881135IPR017930Myb domain
SMARTSM007171.8E-1685133IPR001005SANT/Myb domain
PfamPF002491.5E-1586129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2688133IPR009057Homeodomain-like
CDDcd001673.62E-1288129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MSKMTNGGED NKRSKNRRDS PSVEEASNGP LKKGPWTAAE DAILVEYVTK HGEGNWNAVQ  60
KHSGLSRCGK SCRLRWANHL RPDLKKGAFT PEEERRIIEL HAKMGNKWAR MAAELPGRTD  120
NEIKNYWNTR IKRLQRAGLP VYPPEVCQQV LNGSQESQNM GTLQNTDACG PDLIQSDHFE  180
IPEVEFKNLE LNRGLIYSPT VLDIPTSSML KSGVCSSHGS SFMLPTMHPH KRLRESQTIF  240
PSLDGGVGSG LSAFNQSTDY FSEKITESFD ISSQYDSHTN TFGQPPLCVL PGSHALLNDN  300
SSSSEPLCGA MKLELPSLQY PETQQDSWGT PNSPLPSLES VDTLILSPPA EQTQSDCLSP  360
RSSGLLEAVL YESQTLKNSK KCSGHQTSDT SVATGDVEDC PFNTYNTEWE VHHDPNSPLG  420
HSAASVFSAC TPISGSSSDE PGFELKPETT NQVSTPYIEG KEAPKQIDFT RPDVLLGSGW  480
FGLGSGFVNN QSVRTDEVGA CLGDDIDSEC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31311335106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075987.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067KE640.0A0A067KE64_JATCU; MYB family protein
STRINGPOPTR_0009s02380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.12e-98myb domain protein 65